News Videos
This Bitcoin Breakout Could Start A Monster Rally
🧠 Your AI Platform for Crypto, Markets, and Sports ► https://www.askclash.ai/
🎯 Predict Crypto, Sports, & Markets. Free Entries, Real Winnings ► https://www.clashpicks.com/
**Exchange Partners**
🟩Bitunix Exchange ► *$100,000 Deposit Bonus* ► https://bit.ly/3Tmp1Hq
🟦BTCC Exchange ► *10% Deposit Bonus* ► https://bit.ly/4kk20Qa
🟨MEXC Exchange ► *Zero Fees* ► https://tinyurl.com/4ukfyd3t
**CryptosRus**
🟧CryptosRus Site ► https://cryptosrus.com/
🟧Join *CryptosRus Discord* ► https://discord.com/invite/cryptosrus
**Clash**
✅Learn More About $Clash ► https://cryptosrus.com/#clash-token
✅Clash CA: 6nR8wBnfsmXfcdDr1hovJKjvFQxNSidN6XFyfAFZpump
💜Join *Discord* ► https://discord.com/invite/cryptosrus
0:00 Intro
0:45 Market Overview
1:20 Iran Peace
2:45 Payroll Data
5:00 AI
7:05 Saylor
8:05 Bitcoin Exchange Reserves
9:10 New York
9:45 Bitcoin Buyers
11:40 Tom Lee
14:20 Ondo
15:00 XRP
16:20 Charts
18:15 Q&A
🔴Full Disclaimer: This video and its contents are for informational purposes only and do not constitute an offer to sell or trade, a solicitation to buy, or recommendation for any security, cryptocurrency, or related product, nor does it constitute an offer to provide investment advice or other related services by CryptosRUs. CryptosRus may have a financial investment with the cryptocurrencies discussed in this video. In preparing this video, no individual financial or investment needs of the viewer have been taken into account nor is any financial or investment advice being offered. Any views expressed in this video were prepared based upon the information available at the time such views were written. Changed or additional information could cause such views to change.
source
News Videos
The Clarity Act is About to Ruin Crypto
Create your Free Account at Caleb & Brown:
👉 https://www.calebandbrown.com/affiliates/keithd/
Get in touch with Jim via email for any questions: jim.bazzani@calebandbrown.com
Create Your Free Account at iTrustCapital for Tax-Free Crypto Trading in your IRA:
👉 https://www.itrustcapital.com/go/keithd
📹 Become a Channel Member (Exclusive Videos): https://www.youtube.com/channel/UCAFqzhDwJd12pBDgdk-2GqA/join
📖 Or Join My Patreon (Weekly Newsletter): https://www.patreon.com/c/theinneroperator/
🎙️Subscribe to Memes and Markets: https://www.youtube.com/@memesandmarketspod
For a 1:1 conversation, book your paid consultation here: https://calendly.com/keithsmithspeaks
All Sponsorship & Business Enquiries: keithdenterprise@gmail.com
source
News Videos
Did You End Up Winning or Losing? Xiaohui’s Financial Fun
Description: Dive into Xiaohui’s hilarious journey of financial wins and losses! Discover if she triumphed or stumbled. Get ready for a laugh and some valuable money lessons. Don’t miss out on this entertaining look at finance
source
News Videos
BITCOIN & CRYPTO: The Calm Before The Storm!!! – Bitcoin News Today, Ethereum & Altcoins
BITCOIN & CRYPTO: The Calm Before The Storm!!! – Bitcoin News Today, Ethereum & Altcoins
🔵 *Toobit* 👉 https://bit.ly/TOOBIT 👈 *($10,650 BONUS)*
► *No KYC* required, & Earn Up To *$10,650 in Bonuses!*
🟢 *Bitunix* 👉 https://bit.ly/BITUNIX 👈 *($50,000 Prize Pool)*
► *No KYC* required, & Earn Up To *$50,000 in Prizes!*
🔶 *Pionex* 👉 https://bit.ly/PIONEX_ 👈 *($100,000 PRIZES)*
🟧 *Bybit* 👉 https://bit.ly/BybitJosh 👈 *($30,050 BONUS)*
► How To Trade on Bybit (Tutorial): https://youtu.be/oIr4rxDb82U
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
💬 *My Official Social Media:*
► X (Twitter): https://twitter.com/CryptoWorldJosh
► Instagram: https://instagram.com/CryptoWorldJosh
► Backup YouTube channel: https://www.youtube.com/CryptoWorld2nd
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
*Crypto World ESSENTIALS*
⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇⬇
💰 *Crypto Trading Course:* https://cryptoworldjosh.com
💳 *Bybit Card:* https://bit.ly/BYBITcard *(Up to 10% Cashback)*
📈 *TradingView:* https://bit.ly/TradingViewJosh *(TA Chart Platform)*
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬
Timestamps:
Bitcoin Price Analysis! 0:00
Bitcoin Dominance! 4:02
Ethereum Price Analysis! 4:28
XRP Price Analysis! 5:16
Solana Price Analysis! 6:20
Chainlink Price Analysis! 8:11
#Bitcoin #BTC #BitcoinPrice #Ethereum #ETH #Chainlink #CryptoWorld #Solana #SOL #Cryptocurrency #Invest #Crypto #TheFed #News #marketanalysis #entrepreneur #business #success #investment #finance #bitcoins #StockMarket #BestCryptocurrency #AltcoinSeason #AltSeason #XRP #XRPnews #XRPripple #XRPcoin #XRParmy #XRPupdate #XRPcommunity #LINK #ChainlinkCrypto #AltcoinCrash
*DISCLAIMER*
The information presented in this video is for educational and entertainment purposes only and is not financial advice. I am not a financial advisor. Trading can result in loss of funds. Individuals must consider all risk factors including their own personal financial situation before trading. All individuals are responsible for their own trades and investments. Crypto World, “Josh” and affiliates are not responsible for individual loss due to poor trading decisions or any other actions which may lead to loss of funds.
This information is what was found publicly on the internet. This information could’ve been doctored or misrepresented by the internet. All information is meant for public awareness and is public domain. This information is not intended to slander harm or defame any of the actors involved but to show what was said through their social media accounts. Please take this information and do your own research.
This video relates to the following:
bitcoin, btc, bitcoin news, btc news, bitcoin price, btc price, bitcoin news today, bitcoin today, btc news today, btc today, crypto, cryptocurrency, cryptocurrencies, digital currency, digital currencies, crypto world, cryptoworld, cryptowrld, crypto news, cryptocurrency news, altcoins, altcoin news, best altcoin, best altcoins, ethereum, litecoin, bitcoin cash, news, bitcoin breakout, bitcoin price target, bitcoin price prediction, btc price target, btc price prediction, price prediction bitcoin, price prediction btc, ethereum price, eth price, ethereum today, eth today, ethereum price now, eth price now, ethereum news, eth news, ethereum breakout, eth breakout, price prediction 2026, price target 2026, btc target, eth target, bitcoin price breaking out, bitcoin price breakout, ethereum price breakout, ethereum price breaking out now, 2026, end for bitcoin, bitcoin crash, bitcoin price prediction, bitcoin price prediction 2026, bitcoin 2026, bitcoin crash, bitcoin crashed, crash bitcoin, bitcoin dump, bitcoin pump, bitcoin dip, buy the dip, bitcoin bear market, bitcoin bull market, new prediction, new bitcoin price prediction, bitcoin explained, bitcoin analysis, buy bitcoin, bitcoin sell off, bitcoin bottom, ethereum crash, ethereum breakdown, ethereum dip, ethereum crash 2026, buy ethereum, buying ethereum, alt season, altcoin season, altseason, altcoin season 2026, alt season 2026, technical analysis, bitcoin technical analysis, trending cryptocurrency today, crypto predictions today, when will bitcoin crash, ethereum technical analysis, ethereum signal, bitcoin conference, crypto news, recession, stock market, ethereum merge news, solana, sol, solana price prediction, solana crypto, solana news today, solana news, solana coin, solana technical analysis, bitcoin etf, btc etf, blackrock bitcoin etf, bitcoin blackrock etf, xrp price prediction, xrp news, xrp, cardano, cardano ada, cardano news, chainlink, chainlink crypto, link coin, link crypto, chainlink news today, chainlink price prediction, altcoin season 2026, alt season 2026, altcoin season prediction, alt season prediction, altseason 2026 prediction, trump coin, trump meme coin, trump crypto, bitcoin reserve.
– Crypto World –
source
News Videos
she eat all day (im she) #adulting #money #recruitment #jobsearch #intern
News Videos
Crypto Alert: Bitcoin Starting To Bubble Up
Bitcoin on the edge of bear rejection or bullish breakout
MoneyZG Crypto Investor Course: https://moneyzg.academy
My Ultimate Crypto Investing Guide & Community
Bybit $30,000 Bonus: https://bit.ly/Bybit-ZG
My Top Centralised Exchange (No US/UK Allowed👇🏻)
Apex 10% Fee Discount: https://bit.ly/ApexDEX-ZG
Bybit’s DeX: Trade Crypto From Your Wallet (Tutorial Below)
Trade on Kraken: https://bit.ly/Kraken-MZG
Best Fiat On/Off Ramp For USA (USD, GBP, EUR, AUD, CAD, CHF, JPY)
FOLLOW ME:
X: https://bit.ly/Twitter-ZG
Instagram: https://bit.ly/Instagram-ZG
TikTok: https://www.tiktok.com/@moneyzg
TIMESTAMPS:
USEFUL VIDEOS:
Bybit: https://youtu.be/L7_LjF1YsKw
Apex: https://youtu.be/MxjjBUUBO1Y
Blofin: https://youtu.be/zrx0OP3iJC0
This video is for entertainment purposes only. It is not financial advice and is not an endorsement of any provider, product, asset or service. I assume no liability for errors or omissions. I disclaim responsibility for losses. I disclaim liability for loss or damage via your use of third party sites. Crypto is high risk; you can lose all your money. You are not protected if something goes wrong. Links above include affiliate links. I’m part of an affiliate network and I receive compensation from partnering websites. Do NOT trade products or on platforms that are unsuitable or restricted in your jurisdiction. Bonuses and communications not intended for UK.
source
News Videos
#life #money #motivation #lifelessons #motivationalspeech #viral #trending #youtubeshorts
News Videos
understand business psychology in 6 second 2026 #money #finance
understand business psychology in 6 second 2026 #money #finance
#money #moneybaggyo #moneyman #moneyfornothing #moneymoneymoney #moneytalks #moneytreeskendricklamar #moneysong #moneyfornothingdirestraits #moneymoneygreengreen #moneypinkfloyd #moneysubliminal #moneycardib #moneybaggageyo #moneysignsuede #moneyinthegrave #moneyand #moneyandpeacefinesse2tymes #moneyandthepower #moneyandviolence #moneyandmacro #moneyandvibesnemzzz #moneyandthepowerscarface #moneyanddrugsplayboicarti #moneyandclothessofaygo #moneyandfame #moneyandpowderrickross #moneyandmurdagizwop #moneyandviolenceseason1 #moneyandpowerstunnagirl #moneyandproblems
#finance #financenews #financebro #financeforbeginners #financepodcast #finance101 #financehydra #financecourse #financemajor #financewithsharan #financedegree #financenewstoday #financenewslive #financecouple #financebrofinancebabe #financeand #financeandmaneuver #financeandliberty #financeandinvestment #financeandaccounting #financeandeconomics #financeandai #financeandinvestingforbeginners #financeandcapitalmarketskhanacademy #financeandfelonygta5 #financeandinsurancemanagertraining #financeandclosingrealestate #financeandbudgeting #financeandbusiness #financeandstocksforbeginners
#business #businessinsider #businesscasualoutfits #businessideas #businessproposal #businessnews #businessbasics #businesswithbrian #businessideas2026 #businesseminem #businesstimesflightoftheconchords #businesstiesto #businessanalyst #businessinsiderfood #businesscasualformen #businessand #businessandhobbiessims4 #businessandpleasureumbrella #businessandhobbiessims4review #businessandfinance #businessandhobbiessims4build #businessandmarketing #businessandhobbiessims4gameplay #businessandhobbiessims4ideas #businessandfinancelesson1 #businessandgod #businessandhobbiessims4trailer #businessandhobbies #businessandeconomics #businessandentrepreneurship
Tags –
money, na money, money song, lisa money, money lisa, u.s. money, marin money, lisa – money, money lyrics, money spread, money glitch, the money song, money for kids, by индия money, fan flex money, the money trap, counting money, cleyton m money, money cleyton m, how money works, yelawolf money, money counting, money handling, american money, money count song, money pink floyd, lisa money letra, how to make money, how to save money, money dispenser, james jani money, how to count money, money lyrics lisa, money lisa lyrics
source
News Videos
$10 TRILLION for Crypto! BlackRock JUST WENT All In – Raoul Pal
Grow your crypto and gold tax-free with iTrustCapital IRA — no monthly fees, and get a $100 bonus when you fund your account.
https://www.itrustcapital.com/go/savvy-finance
The crypto market may be approaching one of the most important turning points in its history. The Senate Banking Committee has officially scheduled the CLARITY Act markup hearing for May 14, a move that could finally establish the first real crypto market structure framework in the United States. At the same time, BlackRock is launching tokenized money-market funds on Ethereum while Japan moves government bonds onto blockchain infrastructure.
In this video, we break down why Wall Street giants, sovereign nations, and macro experts like Raoul Pal believe tokenization, stablecoins, AI agents, and blockchain rails could reshape the future of global finance. We also cover the latest CLARITY Act stablecoin negotiations, the growing battle between regulators and banks, and why many investors believe the biggest crypto expansion phase may still lie ahead.
If you enjoy detailed crypto, macro, Bitcoin, Ethereum, tokenization, stablecoin, and financial market analysis, make sure to like the video, subscribe, and turn on post notifications for more updates on the rapidly evolving digital asset industry.
—————————————————————————————————————————
Sources: Raoul Pal The Journey Man
AI Agents Take Over Markets | Raoul Pal the Journey Man
—————————————————————————————————————————
👉 FINANCIAL DISCLAIMER
This channel is intended to share tips and investment videos by experts. We DO NOT GIVE FINANCIAL ADVICE! Please consult a licensed financial advisor and do your own research before making any financial action.
source
News Videos
Cecilia Malan relembra quando o pai foi Ministro da Fazenda: “Orgulho”
No episódio desta semana do Desculpa Alguma Coisa, Tati Bernardi recebe a jornalista e escritora Cecília Malan. Ela falou do seu livro “Eu e Elas”, da boa relação com a família e da entrevista emocionante com Gisèle Pelicot.
Filha do ex-ministro da Fazenda Paulo Malan, a jornalista conta como foi ingressar na profissão e o apoio que recebeu da família após o fim do seu casamento com um francês.
🎙️ O videocast tem episódio inédito toda quarta no YouTube de Universa, toda sexta às 23h no Canal UOL e a qualquer hora no UOL Play.
#ProgramasCanalUOL #DesculpaAlgumaCoisa #TatiBernardi #shorts
source
News Videos
Crypto Trading Bootcamp Ep 12: Risiko dan Money Management dalam Kripto
Gabung Komunitas Gratis: https://discord.gg/akademicrypto
Belajar Sekarang: https://akademicrypto.com
Buku & Merchandise:
Tokopedia: https://tk.tokopedia.com/ZS9JWhp6F
Shopee: https://s.shopee.co.id/9paY4teGRN
Beli Bitcoin Disini: https://floq.co.id
Instagram AC: https://www.instagram.com/akademicryptocom
Instagram Timothy Ronald: https://www.instagram.com/timothyronaldd
Instagram Kalimasada: https://www.instagram.com/kalimasada97
source
-
Crypto World13 hours agoBloFin War of Whales 2026 Grand Prix opens registration for $5M trading championship
-
Fashion5 days agoCoffee Break: Travel Steam Iron
-
Fashion20 hours agoWeekend Open Thread: Theory – Corporette.com
-
Politics5 days agoWhat to expect when you’re expecting a budget
-
Fashion6 days agoWhat to Know Before Buying a Curling Wand or Curling Iron
-
Tech6 days agoAuto Enthusiast Carves Functional Two-Stroke Engine from Solid Metal
-
Crypto World20 hours agoE-Estate Announces 1 Year Live: Washington DC Summit as Real Estate Tokenization Enters Its Next Phase
-
Tech1 day agoTech Moves: Microsoft AI leader jumps to OpenAI; former AI2 exec joins Meta; and more
-
Tech5 days agoGM Agrees To Pay $12.75 Million To Settle California Lawsuit Over Misuse Of Customers’ Driving Data
-
Crypto World6 days agoCZ says US crypto rivals tried to block Trump pardon
-
Tech5 days agoGM agrees to $12.75M California settlement over sale of drivers’ data
-
Crypto World3 days ago
Bitcoin Suisse expands with Digital Asset License and Investment Business Act Registration Approval in Bermuda
-
Politics4 days agoPakistan to enter Chinese capital market as war inflation bites
-
Crypto World2 days agoGoogle’s Gemini AI Predicts Incredible Solana Price by the End of 2026
-
Crypto World4 days agoBitcoin Suisse expands with Digital Asset License and Investment Business Act Registration Approval in Bermuda
-
Politics6 days agoSky News Presenter Says Keir Starmer Is Not Waving But Drowning
-
Crypto World7 days ago
Hacker Drains $5.9M From Ethereum Liquidity Provider TrustedVolumes
-
Fashion6 days agoAmazon Sundays: Spring Glassware & Vases
-
Business23 hours agoH&R Real Estate Investment Trust (HR.UN:CA) Q1 2026 Earnings Call Transcript
-
Entertainment6 days agoPrime Video’s Forgotten but Brilliant 2-Part Horror Anthology Is a Perfect Binge

You must be logged in to post a comment Login